PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010091789.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 1529aa    MW: 171984 Da    PI: 6.3857
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010091789.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.53e-33267321155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr+rWtpeLHe+Fveav+qLGGse+AtPk +l+lmkv++Lt++hvkSHLQkYR+
  XP_010091789.1 267 KPRMRWTPELHEAFVEAVNQLGGSERATPKGVLKLMKVESLTIYHVKSHLQKYRT 321
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-31264323IPR009057Homeodomain-like
PROSITE profilePS5129411.229264324IPR017930Myb domain
SuperFamilySSF466892.51E-17265321IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-24267321IPR006447Myb domain, plants
PfamPF002498.1E-9269320IPR001005SANT/Myb domain
PfamPF143793.9E-23352397IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene3DG3DSA:3.30.40.106.6E-29531618IPR013083Zinc finger, RING/FYVE/PHD-type
SuperFamilySSF578505.42E-33533615No hitNo description
PfamPF145691.4E-37537610IPR027934Cellulose synthase, RING-type zinc finger
PfamPF035523.4E-2838161342IPR005150Cellulose synthase
SuperFamilySSF534483.19E-10829886IPR029044Nucleotide-diphospho-sugar transferases
SuperFamilySSF534483.19E-109841043IPR029044Nucleotide-diphospho-sugar transferases
SuperFamilySSF534483.19E-1010811140IPR029044Nucleotide-diphospho-sugar transferases
SuperFamilySSF534483.19E-1012371371IPR029044Nucleotide-diphospho-sugar transferases
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0030244Biological Processcellulose biosynthetic process
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0071555Biological Processcell wall organization
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0016760Molecular Functioncellulose synthase (UDP-forming) activity
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 1529 aa     Download sequence    Send to blast
MEARPALSIP RSGTTQLTNM GVSGAFTSSL PVLPTPYEES YPKLPDSQQV SIERELMTSP  60
LTHASHLTSN SGVMGHIFSS SSGFSSDLHY SSVSLSQQKI QSRNTPFIPQ SSTNGVSFSV  120
PQSSYSTLLH STTSSHYTKE NSASWCTDSV EDLLDFSVNT PVENSQVESS SCSGIVASDE  180
FGRRNDWQDW ADQLITDNNA LNSSWDEFLA DTNVAEMEPK MAYQVEKPPS FQAQHPQLHQ  240
QHSAPSGEIQ TVATPSCSTN SATASAKPRM RWTPELHEAF VEAVNQLGGS ERATPKGVLK  300
LMKVESLTIY HVKSHLQKYR TARYRPESSE GSSEKRLTPI DEISSLDLKT GIEITEALRL  360
QMEVQKRLHE QLEIQRNLQL RIEEQGRYLQ IMFEKQKSGM DKLKASSSTL GNPSAVSSDA  420
IQGSPEKGEQ EASKIDDGKT ENDSSDAKTT TRGGSDELGE QKEAPQGKVP DNHEPDVCET  480
DPTPSHITTS SFASLHQPCF LHITFFAFAM AGFVTGSHTR NDLQVSDAEQ NSRPLTRQAA  540
SRICRVCGDE IGYKENGDLF VACHVCGFPV CRPCYDYERS DGNQSCPQCN TRYRRHKGCP  600
RVAGDDDDSD DGDDFDDEFR MKNHHSDNSD DHRINPLTNN SDNGEHNQQQ WQPNGHAFSV  660
AGSAAKEFEG EKEVYGNDEW KDRVEKWKVR QERRGNLLNK DDGNNDQGDD EDYLLAEARQ  720
PLWRKIPIPS SLISPYRIVI VLRLLILCFF FRFRILTPAY DAFPLWLISV ICEIWFAFSW  780
ILDQFPKWCP VTRQTYLDRL SIRFERDGEP NRLSPVDVYV STVDPLKEPP IITANTVLSI  840
LSVDYPVDKV CCYVSDDGAS MLLFDSLAET AEFARRWVPF CKKHNIEPRT PEFYFSEKID  900
YLKDKVHPSF VKERRAMKRE YEEFKVRINA LVAKAQKKPE DGWVMQDGTP WPGNNTRDHP  960
GMIQVYLGSG GALDVEGKEL PRLVYISREK RPGYQHHKKA GAMNALVRVS AVLSNAPFML  1020
NLDCDHYINN SKALREAMCF LMDPQLGKKL CYVQFPQRFD GIDLHDRYAN RNTVFFDINM  1080
KGLDGIQGPV YVGTGTVFNR QALYGYDPPV SEKRPKMTCD CWPSWCCCCC GSSRKSKSKK  1140
KGLASLLGGL YTKKKKMMGK NYVRKGSGAM FDLEEIEEGL EGYEELEKSS LMSQKNFEKR  1200
FGQSPVFIAS TLMEDGGLPE GTNSTTLIKE AIHVISCGYE EKTEWGKEIG WIYGSVTEDI  1260
LTGFKMHCRG WKSVYCIPKR PAFKGSAPIN LSDRLHQVLR WALGSVEIFL SRHCPLWYGY  1320
GGKLKLLERL AYINTILNNL ASVWFLALFL SIIATGVLEL RWSGVSLEDW WRNEQFWVIG  1380
GVSAHLFAVF QGLLKVLAGV DTNFTVTAKA ADDAEFGELY LFKWTTLLIP PTTLIILNMV  1440
GVVAGISDAI NNGYGSWGPL FGKLFFSFWV ILHLYPFLKG LMGRQNRTPT IVVLWSILLA  1500
SIFSLVWVRI DPFLPKQTGP ILKQCGVEC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1weo_A1e-22526602277cellulose synthase, catalytic subunit (IRX3)
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
111381155KKKGLASLLGGLYTKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010091789.10.0OsCesA4 protein
SwissprotQ84JA60.0CESA4_ARATH; Cellulose synthase A catalytic subunit 4 [UDP-forming]
TrEMBLW9RB710.0W9RB71_9R
STRINGVIT_07s0005g04110.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-93phosphate starvation response 1